PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010086980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family WRKY
Protein Properties Length: 186aa    MW: 21686.3 Da    PI: 9.7654
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010086980.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.21.2e-31109167159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk+s+fprsYY+Ct++gC+vkk+++r  +d+ +v++tYeg H+h+
  XP_010086980.1 109 LDDGYRWRKYGQKTVKNSKFPRSYYKCTYQGCNVKKQIQRHCKDEGIVVTTYEGMHTHP 167
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-3294167IPR003657WRKY domain
SuperFamilySSF1182908.76E-29101168IPR003657WRKY domain
PROSITE profilePS5081129.023104169IPR003657WRKY domain
SMARTSM007741.2E-36109168IPR003657WRKY domain
PfamPF031061.8E-25110167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MIFLNSPPTS KAPEHVSKYN ASDLWAHFHG IDNSVEYHDR EVKETVNKFD GHIMEAYHNK  60
SGHIGGDHES GPSYNCSEKN KKKPGKRQGE KVTRRHKFAF QTRSQVDVLD DGYRWRKYGQ  120
KTVKNSKFPR SYYKCTYQGC NVKKQIQRHC KDEGIVVTTY EGMHTHPLER SVENFDQILK  180
GMRTSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2699168776Probable WRKY transcription factor 4
2lex_A2e-2699168776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010086980.11e-140putative WRKY transcription factor 75
TrEMBLW9QX941e-140W9QX94_9R
STRINGVIT_17s0000g01280.t015e-52(Vitis vinifera)
STRINGSi026859m2e-51(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-46WRKY DNA-binding protein 75